SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002577 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002577
Domain Number 1 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 643-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000158
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002577   Gene: ENSMMUG00000001930   Transcript: ENSMMUT00000002727
Sequence length 695
Comment pep:known chromosome:MMUL_1:19:44024522:44047300:-1 gene:ENSMMUG00000001930 transcript:ENSMMUT00000002727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACESITFGDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLGHSISKPDLITLLEQ
GKEPWMIVGEETRGECTDLDSRYEIISDGKMHLYRKQSSVTLHQRIHNGQKPYECKECQK
AFSHLTELIVHQRIHTSEEPDQREEFGKAFSHLTDLREHQKIHAREKPYECEECGKVFSY
PANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLS
RHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHKR
IHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSGHQLTAPHTFESV
EKPYKCEECGKAFSVYGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKPY
KCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQE
CGKGFSYSHKLTIHRRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNKCGKS
FRFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSHA
SHLIIHERIHTSDKPYECKRCGKAFRCASYLVRHERVHADGNPYMCEECGKAFNSSHELS
IHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences ENSMMUP00000002577 XP_005589113.1.63531 XP_014979083.1.72884 XP_014979084.1.72884 XP_015296720.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]