SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002986 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002986
Domain Number 1 Region: 44-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000223
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002986
Domain Number - Region: 95-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0512
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002986   Gene: ENSMMUG00000002234   Transcript: ENSMMUT00000003164
Sequence length 261
Comment pep:known_by_projection chromosome:MMUL_1:13:111596410:111602105:1 gene:ENSMMUG00000002234 transcript:ENSMMUT00000003164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSARTLGTAAGGHGVGKGLSPTVLLPARVASWARSQKAWPLCIIDVNECELYGQEGRPR
LCMHTCVNTPGSYRCTCPSGYLTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVS
PECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMA
TASAPGRAGPNSLRFGIVGGSSRGHFVMQRSDRQTGELILVQTLAGPQTLEVDVDMSEYL
DRSFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences F6W031
ENSMMUP00000002986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]