SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003074 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003074
Domain Number 1 Region: 1256-1453,1481-1506
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.16e-25
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 942-1090,1128-1205
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-23
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 3 Region: 511-659,693-738
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-22
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 125-269,339-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.8e-18
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003074
Domain Number - Region: 1511-1556
Classification Level Classification E-value
Superfamily EF-hand 0.00121
Family Polcalcin 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003074   Gene: ENSMMUG00000002297   Transcript: ENSMMUT00000003255
Sequence length 1688
Comment pep:known_by_projection chromosome:MMUL_1:12:30064228:30167855:-1 gene:ENSMMUG00000002297 transcript:ENSMMUT00000003255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASPEPKGLVPFTKESFELIKQHIAKTHNEEHEEDLKPNPDLEVGKELPFIYGNLSQGM
VSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRGTTIKVLAHPYPF
LLTSTFFRLFILISVLLDCIFMSLTNLPKWRPVLENTLLGIYTFEILVKLFARGVWAGSF
SFLGDPWNWLDFSVTMFEVIIRYSPLNFIPMLQTARTLRILKIIPLNQGLKSLAGVLTHC
LKKLIGVIILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNKTGNPYYIRETE
NFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQD
YPEVLYHQILYASGKVYMIFFVMVSFWFSFYMASLFLGILAMAYEEEKQRVGQTSKKIEP
KFQQTGKELQEGNETDEAKTIQIEMKKRSPTSTDTSLDVLEDATLRHKEELEKSKKICPL
YWYKFATTFLIWNCSPCWSKLKEFVHRIVMAPFTDLFLIICIILNICFLALEHYPMSKST
NNLLNIGNLVFIGIFTAEMIFKIIAMHPYGYFQVGWNIFDSVIVFHGLTELCLANVEGMA
LLRLFRMLRIFKLGKYWPTFQILMRSLSNAWVTLRDLVLLLFIFMFFSAAFGMRLFGQNY
EEFVCHIDQNCQLPRWHMHDFFHSYLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVI
LIGNLLVVYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKKQNV
PKDTMDHVNEVYVKEDISDHTLSELSNAQDFLKDKEKSSGTEKNTTENESQSLIPSPSVS
ETVPVASGESDIENPDNKEIQSKSGDGDSKEKIKQSSSSECSTVDIAISEEEEMFYGSER
SKHPKNGCGRGSSLGQTSGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGALAF
EDIYIDQRKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVPDL
SFLSKTREELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFS
IMGVDLFAGRFYECIDPTSGERFPSSEVMNKSQCESLLFNESMPWENAKMNFDNVGNGFL
SLLQVATFNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLISVII
DNFNRHKIKISTNIFITVKQRKQYRRLKKLMYEDSQRPVPRPRNKLQGFVFDLVTSQVFN
VIVMVLICFQAIAMMIDTDGQSLEMYIALYWINSIFVMLYTMECILKLIALRCFYFTIVW
NIFDFMVVIFSITGLCLPMTVGSYLVSPSFEQLILLSRIIHMLRLGKGPKVFHNLMLPLM
LSLPALLNIILLIFLVMFIYAIFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVAIFA
GWDGMLDAIFNSKWSDCDPDKINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVV
VMEFLNIASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKP
NKGQLIALDLPMAVGDRIHCLDILLAFTKRVMGKDVRMEKLLSEIESGFLLANPFKITCE
PITTTLKRKQEAVSATIIQRAYKNYLLRRNDKNTSHIHMIDDDRDVHATKEGAYFDKAKE
KSPIQSQI
Download sequence
Identical sequences ENSMMUP00000003074 9544.ENSMMUP00000003074 ENSMMUP00000003074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]