SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003222 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003222
Domain Number 1 Region: 40-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-37
Family SCAN domain 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003222   Gene: ENSMMUG00000002402   Transcript: ENSMMUT00000003412
Sequence length 152
Comment pep:novel chromosome:MMUL_1:7:64666302:64669186:-1 gene:ENSMMUG00000002402 transcript:ENSMMUT00000003412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVDQQIQTPSVQDLQTVKLEEDSHWEQEISLQGNYSGPETSCQSFWHFHYQEASGPR
EALLQLRKLCCQWLRLEKCTKEQILELLVLEQFLTVLPQEIQIWVPQQHPESGEEAVALV
KDLQKEPGRQRLEPLLFYVWDVLGRTAWDAEA
Download sequence
Identical sequences F6PPW5 G7P9D0
9544.ENSMMUP00000003222 ENSMMUP00000003222 ENSMMUP00000003222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]