SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003310 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003310
Domain Number 1 Region: 39-576
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-dependent enzymes 1.73e-220
Family Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain 0.00000000000898
Further Details:      
 
Domain Number 2 Region: 581-740
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.09e-56
Family Cobalamin (vitamin B12)-binding domain 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003310   Gene: ENSMMUG00000002458   Transcript: ENSMMUT00000003501
Sequence length 750
Comment pep:known chromosome:MMUL_1:4:49172452:49207496:-1 gene:ENSMMUG00000002458 transcript:ENSMMUT00000003501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAKNQLFLLSPHYLKQVKESSGSRLIRQRFLHQQQPLHPEWAALAKKQLKGKNPEDLI
WHTPEGISIKPLYSKRDTTDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESN
KFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLE
KMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMK
IIADIFQYTSKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDE
FAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKSSKSLLLRAHCQTSGWSLTE
QDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPK
VADPWGGSYMMESLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARID
SGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLQKIKSSRDQALAERCLAALTEC
AASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSA
IKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQ
AVDADVHAVGVSTLAAGHKTLVPELIKELNSLGRPDILVMCGGVIPPQDYEFLFEVGVSN
VFGPGTRIPKAAVQVLDDIEKCLEKKQQSV
Download sequence
Identical sequences A0A1D5Q5J8 G7P4T4
9544.ENSMMUP00000003310 ENSMMUP00000003310 NP_001248490.1.72884 XP_005552835.1.63531 XP_014991951.1.72884 ENSMMUP00000003310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]