SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003340 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003340
Domain Number 1 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-27
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-23
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 189-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 397-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000944
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 229-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000483
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 313-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000638
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003340   Gene: ENSMMUG00000002484   Transcript: ENSMMUT00000003532
Sequence length 532
Comment pep:known chromosome:MMUL_1:6:175652646:175659079:1 gene:ENSMMUG00000002484 transcript:ENSMMUT00000003532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESVTFRDVAVFFSQDEWLHLGSAQRALYREVMLENYSSLVSLGILFSKPKVISQLEQGE
DPWMVESGVPQGAHLGWESLFEAIISKEENQEVMKKLIIDGAFDFKLEKTYINEDKLEKQ
QGKKNKLFRKVLVTIKKVYMKERSFKGIEFGKNLGLKSSLIRKPRMGSRGRRPRSQQYSV
LFKQLGVNTSKHQRIHTGEKLYKCKECRKAFSQSSSLTQHLRVHTGEKPYICSECGKAFS
FTTSLIGHQRMHTGERPYKCKECGKTFKGSSSLNNHQRIHTGEKPYKCNECGRAFSQCSS
LIQHHRIHTGEKPYECTQCGKAFTSISRLSRHHRIHTGEKPFHCNECGKVFSYHSALIIH
QRIHTGEKPYACKECGKAFSQSSALIQHQRIHTGEKPYKCNECGKAFSWISRLNIHHRIH
TGEKPYNCKECGKAFSSHSGVNTHRKIHTGEKPYKCNDCEKAFNQSSALIQHQRIHTGEK
PYNCKVCGKAFRQSSSLMTHMRIHTGEKPYKCKECGKAFSQSSSLTNHQRTH
Download sequence
Identical sequences ENSMMUP00000003340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]