SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003342 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003342
Domain Number 1 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.29e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 365-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 214-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.58e-20
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 7 Region: 476-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003342   Gene: ENSMMUG00000002485   Transcript: ENSMMUT00000003534
Sequence length 554
Comment pep:known_by_projection chromosome:MMUL_1:6:175680924:175699699:1 gene:ENSMMUG00000002485 transcript:ENSMMUT00000003534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDLLPAQESVTFRDVAVFFSQDEWLHLDSAQRALYREVMLENYSSLVSLGIPFSMPKL
IHQLQQGEDPCLEEREVPSDTCVGFKTWPETEALPHRQDVFVEETSQGMIKEESIKDGPW
DLNSEEAVEFESRIEEEQEKKPLRQMIVSHEKTISEDGNHTSLELEKSLFINTALVAQQS
VPIERIPNMYYTFGEDFKQNLDLMKCFQIYPGGKPHICNECGKSFKQNLHLIEHQRIHTG
EKPYKCNECEKTFSHRSSLLSHQRIHTGEKPYKCNECEKAFSNSSTLIKHLRVHTGEKPY
RCRECGKAFSQCSTLTVHQRIHTGEKLYKCGECEKAFNCRAKLHRHQRIHTGEKPYKCSE
CGKGYSQFTSLAEHQRLHTGEQLYKCLECGRTFTRIATLIEHQRIHTGQKPYQCNECEKA
FNQYSSFNEHRKIHTGEKLYTCEECGKAFGCKSNLYRHQRIHTGEKPYQCNQCGKAFSQY
SFLTEHERIHTGEKLYKCMECGKAYSYRSNLCRHKKVHTKEKLYKWKEYGKPLICSSSLA
QYQRFLRGDKAYEA
Download sequence
Identical sequences F7HGS7
9544.ENSMMUP00000003342 ENSMMUP00000003342 ENSMMUP00000003342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]