SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003651 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003651
Domain Number 1 Region: 1217-1372,1411-1490
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1539-1789
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 769-916,950-997
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 139-283,373-442
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003651
Domain Number - Region: 1796-1835
Classification Level Classification E-value
Superfamily EF-hand 0.02
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003651   Gene: ENSMMUG00000002712   Transcript: ENSMMUT00000003862
Sequence length 2014
Comment pep:known chromosome:MMUL_1:12:28889009:29049710:1 gene:ENSMMUG00000002712 transcript:ENSMMUT00000003862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILIFPLNFVFLDDITLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFES
LIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALKTISV
IPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEI
NITSFFNNSLDGNGTTFNRTVSMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEG
YICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIF
LGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAE
SRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESED
SIRRKGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRTKDIGSE
NDFADDEHSTFEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDC
NGVVSLVGGPSTLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASI
LTNTMEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIV
LNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFI
VSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAI
IVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDC
MEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRM
QKGIDFVKRKIREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKD
GNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEE
SKEKLNATSSSEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGK
GKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFT
YIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRA
LRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYT
TGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYA
AVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMT
EEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVE
TDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFL
AELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVM
FIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDC
DPEKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLS
EDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDR
IHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAII
IQRAYRRYLLKQKVKKVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTS
PPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK
Download sequence
Identical sequences 9544.ENSMMUP00000003651 ENSMMUP00000003651 ENSMMUP00000003651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]