SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003787 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003787
Domain Number 1 Region: 10-234
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-53
Family Kelch motif 0.00043
Further Details:      
 
Domain Number 2 Region: 242-340
Classification Level Classification E-value
Superfamily Kelch motif 1.1e-19
Family Kelch motif 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003787   Gene: ENSMMUG00000002833   Transcript: ENSMMUT00000004012
Sequence length 354
Comment pep:known chromosome:MMUL_1:2:87278614:87283490:-1 gene:ENSMMUG00000002833 transcript:ENSMMUT00000004012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWL
ALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGV
ATVERDGMVYALGGMGPDTAPQAQVCVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLEARTWTRHPSLPSRRAFAGCAMAEGSVFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGHIVAIGGLGNQPCPLGSVE
SFSLARRRWEALPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGV
Download sequence
Identical sequences A0A1D5QNB8 A0A2K5N2D5 A0A2K5ZWU6 A0A2K6C8U6 G8F681
ENSMMUP00000003787 NP_001244521.1.72884 XP_011737602.1.29376 XP_011737603.1.29376 XP_011836319.1.47321 XP_011889064.1.92194 XP_015301388.1.63531 9544.ENSMMUP00000003787 ENSMMUP00000003787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]