SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003798 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003798
Domain Number 1 Region: 40-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.45e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 161-259
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000432
Family Glutathione S-transferase (GST), C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003798   Gene: ENSMMUG00000002839   Transcript: ENSMMUT00000004023
Sequence length 309
Comment pep:known chromosome:MMUL_1:10:20171924:20203936:-1 gene:ENSMMUG00000002839 transcript:ENSMMUT00000004023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGGHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVL
DQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNL
QSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFA
YWYLKKKYI
Download sequence
Identical sequences B7Z1I3
ENSMMUP00000003798 NP_001243668.1.87134 NP_001243668.1.92137 XP_004062238.1.27298 XP_011853044.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]