SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003871 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003871
Domain Number 1 Region: 189-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-84
Family Nuclear receptor ligand-binding domain 0.00000000349
Further Details:      
 
Domain Number 2 Region: 136-217
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-31
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003871   Gene: ENSMMUG00000002892   Transcript: ENSMMUT00000004102
Sequence length 463
Comment pep:known chromosome:MMUL_1:1:195235840:195280865:-1 gene:ENSMMUG00000002892 transcript:ENSMMUT00000004102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPDQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences A0A2K6CSH7 F7HDB8 G7NU27
NP_001244539.1.72884 XP_005539901.1.63531 XP_011758650.1.29376 9544.ENSMMUP00000003871 ENSMMUP00000003871 ENSMMUP00000003871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]