SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004150 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004150
Domain Number 1 Region: 576-876
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.95e-37
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 2 Region: 889-1162
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.33e-30
Family Protein kinases, catalytic subunit 0.00034
Further Details:      
 
Domain Number 3 Region: 450-553,582-607
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000979
Family SH2 domain 0.0056
Further Details:      
 
Domain Number 4 Region: 376-437
Classification Level Classification E-value
Superfamily PH domain-like 0.000000639
Family Third domain of FERM 0.022
Further Details:      
 
Domain Number 5 Region: 141-266
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000241
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004150   Gene: ENSMMUG00000003110   Transcript: ENSMMUT00000004400
Sequence length 1175
Comment pep:known_by_projection chromosome:MMUL_1:19:10169278:10198519:-1 gene:ENSMMUG00000003110 transcript:ENSMMUT00000004400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLHHRGTTRGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRMRFYFRNWHGMNPQEL
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFK
NESLGMAFLHLCHLALCRGVPLEEVAKKTSFKDCIPLSFRRQIRQHSALTRLRLRNVFRR
FLQDFQPDRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGEAP
TDPGPESAARPPTHEVLVTGTGGIQWWPVQEEVNKEEGSSGGSGRNPQASLSGKKAKAHK
AIGQPADRLREPLWAYFCDFRDITHVVLKECCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLLEPFVQAKLRPEDGLYLIQWSTSHP
YRLILTVAQRSQAPDGTQSLRLRKFPIEQQAGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRRCLPQPGETSNLIIMRGARASTRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALVSQEIET
ILANTAHLYLLFCETGCVFADIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLASAL
SYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWMAPE
CLPGGPNSLSIAMDKWGFGATLLEICFDGEAPLQSRSSSEKEHFYQRQHRLPEPSCPELA
TLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLIVNPDSSASDPTVFHKRYLKKIRD
LGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIEILRTLYHEHIVKY
KGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEALLSLADLRIGRL
AWPHPLLQATTHCRLGPSQLALLPSVASLAPSLLSGLTSFCLLIFVFLVEMGFHHVGQAG
LELLTSGDPPQPPKKFLELIGITQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCW
ETEASFRPTFKNLIPILKTVHEKYQGQAPSVFSVC
Download sequence
Identical sequences ENSMMUP00000004150 9544.ENSMMUP00000004150 ENSMMUP00000004150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]