SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004249 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004249
Domain Number 1 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.57e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 504-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 138-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004249
Domain Number - Region: 551-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00996
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004249   Gene: ENSMMUG00000001436   Transcript: ENSMMUT00000004503
Sequence length 569
Comment pep:known chromosome:MMUL_1:19:59272186:59279052:-1 gene:ENSMMUG00000001436 transcript:ENSMMUT00000004503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLTLKDVAIEFSQEEWTYLDSAQKTLYRDVILENYRNLVSLAGISPFDLSIISLLEQGK
EPWNVDSQEKIASGNISCKCVNKDLPPKGKNGTGEAFHMVKLEGLESCDEALSFEEVQRD
QHDRRAAGNKLIENQLGVIHAGEKPYKCHECGKVFSQPSNLAGHRRIHTGEKPYKCNECG
KAFRAHSKLTTHQVIHTGEKPYKCKECGKCFTQNSHLASHRRIHTGEKPYKCNECGKAFS
VRSSLTTHQTIHTGEKPYKCNECGKVFRHNSYLAKHRRIHTGEKPYKCNKCGKAFSMHSN
LTKHQIIHTGEKPFKCNECVKVFTQYSHLANHQRIHTGEKPYRCDECSKAFSVRSSLTTH
QAIHTGEKPYKCNDCGKVFTQNSHLASHRGIHSGAKPYKCGECGKAFSQTSQLARHWRVH
TGEKPYKCNECGRAFSVHSSLTIHQTIHTGPKPYKCNDCGKVFRHSSYLAVHQRIHTGEK
PYKCNECGKAFSVHSNLATHQVIHTGEKPYKCNECGKVFTQNSHLANHRRIHTGEKPYRC
NECGKAFSVRSTLTTHMAIHTGDKPYKCN
Download sequence
Identical sequences ENSMMUP00000004249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]