SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004263 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004263
Domain Number 1 Region: 187-275
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 5-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000324
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 
Domain Number 3 Region: 99-184
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000132
Family I set domains 0.016
Further Details:      
 
Domain Number 4 Region: 272-368
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000279
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004263   Gene: ENSMMUG00000003191   Transcript: ENSMMUT00000004521
Sequence length 637
Comment pep:known_by_projection chromosome:MMUL_1:1:136650136:136668923:1 gene:ENSMMUG00000003191 transcript:ENSMMUT00000004521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGS
ADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLNPPTVTLSVEPQTVQEGERV
VFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVST
LVNVHFAPRIVVEPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKS
VTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPP
PDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGP
GTAIIQLEEREVLPVGIIAGATIGASILLIFFFIALVFFLYRRRKGSRKDVTLRKLDIKV
ETVNREPLTMHSDREDDTASVSTATRVMKAIYSSFKDDVDLKQDLRCDTIDTREEYEMKD
PTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQLNTYSRAPASD
YGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLGYPQAPPSGLERTP
YEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV
Download sequence
Identical sequences ENSMMUP00000004263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]