SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004381 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004381
Domain Number 1 Region: 35-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-18
Family Thioltransferase 0.000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004381   Gene: ENSMMUG00000003290   Transcript: ENSMMUT00000004647
Sequence length 172
Comment pep:known chromosome:MMUL_1:16:76666030:76667432:1 gene:ENSMMUG00000003290 transcript:ENSMMUT00000004647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVHPEIINENGNPSYKYFYISAEQVVQGMKEAQERLTGDAFRRKHLEDEL
Download sequence
Identical sequences F7FG46
ENSMMUP00000004381 9544.ENSMMUP00000004381 ENSMMUP00000004381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]