SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004700 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004700
Domain Number 1 Region: 48-172
Classification Level Classification E-value
Superfamily SET domain 6.8e-40
Family Histone lysine methyltransferases 0.00079
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004700
Domain Number - Region: 4-52
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0353
Family Tryptophan biosynthesis enzymes 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004700   Gene: ENSMMUG00000017174   Transcript: ENSMMUT00000004991
Sequence length 175
Comment pep:known chromosome:MMUL_1:9:15157279:15179196:1 gene:ENSMMUG00000017174 transcript:ENSMMUT00000004991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKVITSEEAERRGQ
FYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIA
LFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Download sequence
Identical sequences A0A2J8QJH2 A0A2J8VKM9
ENSMMUP00000004700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]