SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004737 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004737
Domain Number 1 Region: 475-707
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.73e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1455-1705
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-32
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 3 Region: 1130-1292,1329-1406
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 89-246,288-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.84e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004737   Gene: ENSMMUG00000014498   Transcript: ENSMMUT00000005028
Sequence length 2278
Comment pep:known_by_projection chromosome:MMUL_1:1:188894423:189215500:-1 gene:ENSMMUG00000014498 transcript:ENSMMUT00000005028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIDRRYSTKFLDSPNLVYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSVWEQRTSQLRKHMQMSSQEALNR
EEAPSMNPLNPLSSLNPLNTHSSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGD
RSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAGGGEAVVTFEDRARHRQSQRRSR
HRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDPELRGNHGAKEPTIQEERAQDLR
RTNSLMVSRGSGLAGGLDEANAPLVLPHPELEVGKDMVPTEQEPEGSSEQALLGDVQLDM
GRVISQSEPDLSCITANTDKATTESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEA
EIREDDEEVENKKQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLV
IAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLW
NILDFVVVVGALVAFALAQTLVTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCV
VTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKME
VKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIF
YVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQ
NRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFS
LECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAAR
LIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINR
HNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVY
FVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYT
EMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIA
KGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSK
VKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLS
PQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSNHGIYLPSDTQEHAGSGRASSMP
RLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSA
HRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSP
SEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPIPPKPRPLLSYSSLIRHVGSI
SPPADGSEEGSPLTSQALENNNTCLTESSNSPHPRQGQHASPQRYISEPYLALHEDSHAS
DCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAV
Download sequence
Identical sequences ENSMMUP00000004737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]