SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004748 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004748
Domain Number 1 Region: 121-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.35e-45
Family Galectin (animal S-lectin) 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004748   Gene: ENSMMUG00000003565   Transcript: ENSMMUT00000005040
Sequence length 256
Comment pep:known chromosome:MMUL_1:7:118165104:118173567:1 gene:ENSMMUG00000003565 transcript:ENSMMUT00000005040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFLSCNCLCLSLQLHDALSGSGNPNPQGWPGPWGNQPAGAGGYPGASYPGAYPGQAPPG
VYPGQAPPGAYPGAPGAYSGASGVYPGPPSGAGAYPSPGQPSAPGAYPATGPYGAPAGPL
SVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFKRRNDVAFHFNPRFNENNRRVIVCN
TKLDNNWGREERQSVFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRVKQLNEISQL
GISGDIDLTNASYTMI
Download sequence
Identical sequences 9544.ENSMMUP00000004748 ENSMMUP00000004748 ENSMMUP00000004748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]