SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004914 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004914
Domain Number 1 Region: 563-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 619-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.2e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 452-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.48e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 118-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 10 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 11 Region: 3-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 12 Region: 665-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004914   Gene: ENSMMUG00000003688   Transcript: ENSMMUT00000005217
Sequence length 722
Comment pep:known_by_projection chromosome:MMUL_1:19:22395017:22408754:-1 gene:ENSMMUG00000003688 transcript:ENSMMUT00000005217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVFQGLLTFRDVAIEFSLEEWQRLDAAQQNLYRNVMLENYRNLAFLALCLKCVRVVFFN
MSSGSYDAYFRYRFINGIAHYQQIWCFQKIDSDHLTFCFKYSILEQNQIYMPMKELGQSS
TLTKHKRIHTGEKPYKCEECGKAFRQSLTLTKHKIIHSGEKHYKCKECGKTFKQFSTLTT
HKIIHAGKKCYKCEECGKAFNQSSSLSTHKIIHTGEKSYKCEECGKAFIWSSTLTRHKRI
HTGEKPCKCEECGKAFSHSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLTNHKITHTEE
KPYKCKECGKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTAHKIIHTGEKPYK
CEECGKAFIWSSSLTKHKRIHTREKLFKCKECDKAFIWSSTLTRHKRIHTGEKPYKCEEC
GKAFNHSSTLTKHKTIHTGEKPYKCKECGKPFKIPSTLAKHKRIHTREKPYKCEECGKAF
SQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSS
TLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYKCEECGKAFNRSSKLTT
HKIIHTGEKPYKCEECGKAFISSSTLTGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRM
HTGEKPYKCEECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIHTRE
KP
Download sequence
Identical sequences ENSMMUP00000004914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]