SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004918 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004918
Domain Number 1 Region: 771-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 855-912
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 911-968
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.37e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 631-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 967-1024
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 11 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 12 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 13 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 14 Region: 184-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-19
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 15 Region: 1009-1061
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 16 Region: 733-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-17
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 17 Region: 688-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000011
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 18 Region: 1051-1108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000369
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 19 Region: 818-850
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000762
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 20 Region: 143-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000572
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004918   Gene: ENSMMUG00000003688   Transcript: ENSMMUT00000005221
Sequence length 1121
Comment pep:known_by_projection chromosome:MMUL_1:19:22394611:22408742:-1 gene:ENSMMUG00000003688 transcript:ENSMMUT00000005221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLLTFRDVAIEFSLEEWQRLDAAQQNLYRNVMLENYRNLAFLGKTGIAVSKPDLITCLE
QGKEPWNMKRHEMVDKAPAICPHFAQDFWPEQGMEDSFQKVLLRKYEKCGHENLQLRKSC
KSVDECKVHREGYSKLNQCFTTTRSKVFQCGKYLKVFHKFLNSNRHMISITEKSYKCKEC
EKIFHWSSTLTNHKKIHTEDKPYKCEECGKAFKQLSTLITHKITCAEEKIYKCEECGKTF
NQSSNLTTHKIIHSGQKPYKCEQCGKAFIWLSTLTGHKKIHTRGKPCKYEECGKAFICSP
TLTRRKRIHTEEKLYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTK
HKRIHTGEKPYKCEECGKAFRQSLTLTKHKIIHSGEKHYKCKECGKTFKQFSTLTTHKII
HAGKKCYKCEECGKAFNQSSSLSTHKIIHTGEKSYKCEECGKAFIWSSTLTRHKRIHTGE
KPCKCEECGKAFSHSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLTNHKITHTEEKPYK
CKECGKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTAHKIIHTGEKPYKCEEC
GKAFIWSSSLTKHKRIHTREKLFKCKECDKAFIWSSTLTRHKRIHTGEKPYKCEECGKAF
NHSSTLTKHKTIHTGEKPYKCKECGKPFKIPSTLAKHKIIYAGEKLYKCEECGKALNQSS
NLTTHKVINTKEKPNKSEECGKAFVWSSTLTEHKRIHTREKPYKCEECGKAFSQPSHLTT
HKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKII
HTGEKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGE
KPYKCEECGKAFISSSTLTGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYK
CEECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIHTREKPYTCKEC
GKSFNRSSTFTKHKVIHTGVKLYKCEECGKSFFWSSALIRHKKIHTGQQPYKQEKFGKTF
NQFSHLTTDKIIHTGEKLYKPERCASAFDNSNFPKHQENHT
Download sequence
Identical sequences ENSMMUP00000004918 9544.ENSMMUP00000004918 ENSMMUP00000000246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]