SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004932 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004932
Domain Number 1 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.01e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 586-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 415-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 527-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.68e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 247-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 680-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 638-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 211-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004932   Gene: ENSMMUG00000003712   Transcript: ENSMMUT00000005236
Sequence length 737
Comment pep:known_by_projection chromosome:MMUL_1:19:58051359:58072004:-1 gene:ENSMMUG00000003712 transcript:ENSMMUT00000005236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQ
EPWITRNPIYAVNCSDYGNAFCSAFSEIRKIDDPLQHHLQNQSIQKSVKQCHEQNMFGNS
VNQNKSHLLLKQDPDTFDLHEKPLKSNLSFENQKRSSGLKNSAEFNGDGKSLFHANHKQF
YTEMKFPAIAKPINKSQVIKQQRTHDIENAHVCSECGKAFLKLSQFIDHQRVHTGEKPHV
CSICGKAFSRKSRLMDHQRTHTGLKHYECECDKTFLKKSQLNIHQKTHMGEKPYTCSECG
KAFIKKCRLIYHQRTHTGEKPHGCSVCGKAFSTKFSLTTHQKTHTGEKPYICSECGKGFI
EKRRLTAHHRTHTGEKPFICDKCGKGFTLKNSLITHQQTHTEKKLYTCGECGKGFSMKHC
LMVHQRTHTGEKPYKCNECGKGFALKSPLIRHQRTHTGEKPYVCTECRKGFTMKSDLIVH
QRTHTAEKPYTCNDCGKGFTVKSRLIVHQRTHTGEKPYICGECGKGFPAKIRLMGHQRTH
TGEKPYICNECGKGFTEKSHLNVHRRTHTGEKPYVCSECGKGLTGKSMLIAHQRTHTGEK
PYICNECGKGFTMKSTLGIHQQTHTGEKPYKCNECDKTFRKKTCLIQHQRFHTGKTSFAC
TECGKFSLRKNDLITHQRIHTGEKPYKCSDCEKAFTTKSGLNVHQRKHTGERPYGCSDCG
KAFAHLSILVKHKRIHR
Download sequence
Identical sequences ENSMMUP00000004932 ENSMMUP00000004932 9544.ENSMMUP00000004932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]