SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005074 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005074
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0028
Further Details:      
 
Domain Number 2 Region: 30-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000000209
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005074   Gene: ENSMMUG00000003806   Transcript: ENSMMUT00000005387
Sequence length 133
Comment pep:known chromosome:MMUL_1:10:18896760:18910200:1 gene:ENSMMUG00000003806 transcript:ENSMMUT00000005387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLLSLLVLFILLANVQGPGLTDWLFPRRCPTIREECEFRERDVCTRHRQCPDNKKC
CVFSCGKKCLDLKQDVCEMPNETGPCLAFFIRWWYDKKNNTCSTFVYGGCQGNNNNFQSE
ANCLNTCKNKRFP
Download sequence
Identical sequences A0A096NX55 A0A2K5KF97 A0A2K5X966 Q8HZ45
ENSMMUP00000005074 9544.ENSMMUP00000005074 ENSMMUP00000005072 XP_011784317.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]