SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005098 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005098
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 538-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 426-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005098
Domain Number - Region: 137-175
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0247
Family Desulforedoxin 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005098   Gene: ENSMMUG00000003826   Transcript: ENSMMUT00000005414
Sequence length 641
Comment pep:known_by_projection chromosome:MMUL_1:19:46468111:46486405:-1 gene:ENSMMUG00000003826 transcript:ENSMMUT00000005414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGGSISKPDVITLLEQ
EKEPWMVVRKETSRWYPDLESKYGPEKVSPENDISEVNLPKQVIKHISTTLGLEAFYFRN
YSEYGRFEGLQGYQEGHINQKMISCEKLPTYTSHASLICNTHKPYECKECGKYFSRSANL
LQHQSIHTGEKPFECKECGKAFRLHIQFTRHQKFHTGEKPFECNECGKAFSLLTLLNRHK
NIHTGEKLFECKECGKSFNRSSNLVQHQSIHAGVKPYECKECGKGFNRGAHLIQHQKIHS
NEKPFVCKECGMAFRYHYQLIEHCQIHTGEKPFECKECGKAFTLLTKLVRHQKIHTGEKP
FECRECGKAFSLLNQLNRHKNIHTGEKPFECKECGKSFNRSSNLAQHQSIHAGVKPYECK
ECGKGFNRGAHLIQHQKIHSNEKPFVCRECEMAFRYHCQLIEHSRIHTGDKPFECKDCGK
AFNRGSSLVQHQSIHTGEKPYECKECGKAFRLYLQLSQHQKTHTGEKPFECKECGKFFRR
GSNLNQHRSIHTGKKPFECKECGKAFRLHMHLIRHQKLHTSEKPFECKECGKAFRLHMQL
IRHQKLHTGEKPFECKACGKVFSLPTQLNRHKNVHTGEKPS
Download sequence
Identical sequences ENSMMUP00000005098 9544.ENSMMUP00000005098 ENSMMUP00000012540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]