SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005227 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005227
Domain Number 1 Region: 38-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 676-702,737-890
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-37
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 300-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.98e-36
Family Laminin G-like module 0.0053
Further Details:      
 
Domain Number 4 Region: 921-1125
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.21e-31
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 5 Region: 153-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-26
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 6 Region: 532-589
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000583
Family Fibrinogen C-terminal domain-like 0.0037
Further Details:      
 
Domain Number 7 Region: 503-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000296
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005227   Gene: ENSMMUG00000003916   Transcript: ENSMMUT00000005552
Sequence length 1260
Comment pep:known_by_projection chromosome:MMUL_1:20:74362846:74641201:1 gene:ENSMMUG00000003916 transcript:ENSMMUT00000005552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVTGAVLKTLLLLSTQNWNRVEAGNSYDCDDPLVSALPQASFSSSSELSSSHGPGFAR
LNRRDGAGGWSPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSNWVTSYLLMFSDSGWNW
KQYRQEDSIWGFSGNANADSVVYYRLQPSIKSRFLRFLPLEWNPKGRIGMRIEVFGCAYR
SEVVDLDGKSSLLYRFDQKSLSPIKDIISLKFKTMQSDGILLHREGPNGDHITLQLRRGR
LFLLINSGEAKLPTTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHAQGE
FNFVNLDYEGNVSFSCSQPQSMPVTFLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLL
FSELQLVSGSILLFLSDGKLKLNLYQPGKLPSDITAGVGLNDGQWHSVSLSAKKNHLSVA
VDGQLASAAPPLGPEQIYSDGTYYFGGCPDKSFGSKCKSPLGGFQGCMRLISIGGRVVDL
ISVQQGSLGNFSDLQIDSCGISDRCSPNYCEHGGECSQSWSAFHCNCTNTGYRGATCHNS
IYEQSCEAYKHRGNTSGFYYIDSDGSGPLEPFLLYCNMTETTWTIIQHNGSDLTRVRNTN
PENPYAGFFEYVASMEQLQATINRAEHCEQEFTYYCKKSRLVNKQDGTPLSWWVGRTNET
QTYWGGSSPDLQKCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLSYKEHLPVTKIVITD
TGRLHSEAAYKLGPLLCRGDRSFWNSASFDTEASYLHFPTFHGELSADVSFFFKTTASSG
VFLENLGITDFIRIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQWHHVRIERNMKEA
SLQVDQLTRKTQPAPADGHVLLQLNSQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERA
QVTPEVQPGCRGHCSSYGKLCRNGGKCRERPIGFFCDCTFSAYTGPFCSNEISAYFGSGS
SVIYNFQENYLLSKNSSSHAASFHGDMKLSREMIKFSFRTTRTPSLLLFVSSFYKEYLSV
IIAKNGSLQIRYKLNRYQEPDVVNFDFKNMADGQLHHVVINREEGVVFIEIDDNTRRQVH
LSSGTEFSAVKSLVLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHP
DPVTVTGHVTESSCVAQPGTDATSRERTHLFADHSGTIDDKEPLANAIKNDSAVIGGLIA
VVIFILLCITAIAVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELTIQNAVSENQKEYFF
Download sequence
Identical sequences ENSMMUP00000005227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]