SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005537 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005537
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 211-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 350-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000447
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 173-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000335
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 257-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000243
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005537   Gene: ENSMMUG00000001462   Transcript: ENSMMUT00000005880
Sequence length 457
Comment pep:known chromosome:MMUL_1:9:37960262:37973339:1 gene:ENSMMUG00000001462 transcript:ENSMMUT00000005880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLSFEDVTVGFTQEEWQHLDPAQRTLYRDVMIENYSHLVSVGYCIPKQEVIFKLEQGE
QPWILEEELPGQRYPDELACIKQKDASDMNHCSMQSLHCLITINYLLKNNKIESSKNKVC
KVDDQLERCQEIQDRHIWQAPYINNQILTIERGNILGKVFDFSIDPLPSIKIPCKCDLCG
MSLKYISDLFSSKKNYLREKPYECNECEKCFSRKSPLTLHQRVHTGEKPYKCKECGKCFS
RNSHLILHQRTHTGEKPYKCKICGKTFCHKSDVTKHQKTHIGGKPYECIQCGKTFSHNSG
LKVHQRTHTKEKPYEYTEYGKSFSEKSVLTVHQRIHTGEKPYKCNECGKTFYNKSDLTKH
QRTHTGKKPYRCKECGKFFSRNSYLTIHQRMHTGDKPFVCKKCGKTLYHKADYTVHKRTH
RGEKSYYCNECGKTFICNSVLNSHQRKHMGNSYLKIL
Download sequence
Identical sequences ENSMMUP00000005537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]