SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005540 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005540
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 298-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.76e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 466-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.82e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 8 Region: 218-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005540
Domain Number - Region: 177-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0168
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005540   Gene: ENSMMUG00000001462   Transcript: ENSMMUT00000005883
Sequence length 595
Comment pep:known chromosome:MMUL_1:9:37960250:37973119:1 gene:ENSMMUG00000001462 transcript:ENSMMUT00000005883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLFQGSLSFEDVTVGFTQEEWQHLDPAQRTLYRDVMIENYSHLVSVGYCIPKQEVIFKL
EQGEQPWILEEELPGQRYPDEKMHSGMSDREKNYFDSQSIVLSFLSFCHPFLMMLSNCLL
LEVCKVDDQLERCQEIQDRHIWQAPYINNQILTIERGNILGKVFDFSIDPLPSIKIPCKC
DLCGMSLKYISDLFSSKKNYLRKMPHDLSAYRKLFLNSNHEKTHITHRGEEVYGCEQCGK
PFYEQSKLTKHQRIHTGEKPYECNECEKCFSRKSPLTLHQRVHTGEKPYKCKECGKCFSR
NSHLILHQRTHTGEKPYKCKECGKSFSRSSYLIIHQRTHTGEKPYECKICGKTFCHKSDV
TKHQKTHIGGKPYECIQCGKTFSHNSGLKVHQRTHTKEKPYEYTEYGKSFSEKSVLTVHQ
RIHTGEKPYKCNECGKTFYNKSDLTKHQRTHTGKKPYRCKECGKFFSRNSYLTIHQRMHT
GDKPFVCKKCGKTLYHKADYTVHKRTHRGEKSYYCNECGKTFICNSVLNSHQRKHMGEKP
YGCNECGKSFSEKSVLTVHQRIHTGEKPYKCNECGKYYHKSDLTKHQRTHTREKP
Download sequence
Identical sequences ENSMMUP00000005540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]