SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005668 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005668
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-41
Family Galectin (animal S-lectin) 0.0000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005668   Gene: ENSMMUG00000004245   Transcript: ENSMMUT00000006022
Sequence length 139
Comment pep:known chromosome:MMUL_1:19:46005526:46010450:1 gene:ENSMMUG00000004245 transcript:ENSMMUT00000006022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLPVPYTLPVSLSVGSCVIITGTPILTFVKDPQLEVNFYTGTDEDSDIAFQFRLHFGH
PAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPAS
VKMLQVLRDISLTRVLISD
Download sequence
Identical sequences A0A2K5WQP0 A0A2K5Z6D5 A0A2K6DCJ7 C5HZ20 F6YWA7
ENSMMUP00000005668 XP_011763096.1.29376 XP_011828783.1.47321 ENSMMUP00000005668 ENSPANP00000004725 9544.ENSMMUP00000005668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]