SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005716 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005716
Domain Number 1 Region: 49-125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.87e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005716   Gene: ENSMMUG00000004271   Transcript: ENSMMUT00000006072
Sequence length 181
Comment pep:known_by_projection chromosome:MMUL_1:7:89353518:89479960:-1 gene:ENSMMUG00000004271 transcript:ENSMMUT00000006072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYA
AGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKI
REMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQKRNISWI
S
Download sequence
Identical sequences ENSMMUP00000005716 XP_014998848.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]