SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005853 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005853
Domain Number 1 Region: 38-351
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.29e-64
Family Crotonase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 361-543
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.83e-50
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000581
Further Details:      
 
Domain Number 3 Region: 543-646
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.53e-27
Family HCDH C-domain-like 0.00053
Further Details:      
 
Domain Number 4 Region: 669-762
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.38e-21
Family HCDH C-domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005853   Gene: ENSMMUG00000004380   Transcript: ENSMMUT00000006222
Sequence length 763
Comment pep:known chromosome:MMUL_1:13:26131910:26189076:-1 gene:ENSMMUG00000004380 transcript:ENSMMUT00000006222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSK
VNTLSKELHSEFTEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLSACKTLQEVTQLS
QEAQRILEKLEKSPKPVVAAINGSCLGGGLELAISCQYRIATKDRKTVLGVPEVLLGALP
GAGGTQRLPKMVGVPAALDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKPPEERTMEYL
EEVAITFAKGLADKKISPKRNKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSDAGYLSESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKD
VKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTGLDRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSRDTSASAVAVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA
EDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLK
LPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQTIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
Download sequence
Identical sequences A0A2K5WXU8 A0A2K6E7T3 I0FL67
ENSMMUP00000005853 NP_001252819.1.72884 XP_005576406.1.63531 XP_011736352.1.29376 9544.ENSMMUP00000005853 ENSMMUP00000005853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]