SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005907 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005907
Domain Number 1 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 3-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 196-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000133
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005907   Gene: ENSMMUG00000004430   Transcript: ENSMMUT00000006280
Sequence length 522
Comment pep:known_by_projection chromosome:MMUL_1:19:58856832:58866181:-1 gene:ENSMMUG00000004430 transcript:ENSMMUT00000006280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLLQGLLTFRDVAIEFSQDEWKCLDPAQRSLYRDVMLENYRNLVSLDISSKCMLKTLSS
TGQGNTEVILTGTLQRQASHHTGEFCLHEIGKDIHDFDFQWKEDETNGHAAPLTKIKELT
GNTDRHDQRHAGNKHIKDQLGSSFHSHLSELHVFQPVWKIGNQVEKSINNASSVSTAQRI
SDRPKTLISSKYGNNYLHSSLLTQKWEGHMREKSFECIESFKSFNCSSLLKKHQIIHLEE
KQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYE
CEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFVYNSYLAKHTILHTGEKPYTCNEC
GKVFNRLSTLARHRRLHTGEKPYKCEECDKVFSRRSHLERHRRIHSGEKPYKCEECDKVF
SRKSNLERHRRIHTGEKPYKCKVCGKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFRQTS
SLIIHRRLHTGEKPYKCNECGKTFSQMSSLVYHHRLHSAEKS
Download sequence
Identical sequences ENSMMUP00000005907 ENSMMUP00000005907 9544.ENSMMUP00000005907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]