SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006118 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006118
Domain Number 1 Region: 537-684
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.26e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 461-535
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000604
Family Glutathione S-transferase (GST), N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006118   Gene: ENSMMUG00000004605   Transcript: ENSMMUT00000006505
Sequence length 686
Comment pep:known_by_projection chromosome:MMUL_1:3:11853876:11905966:-1 gene:ENSMMUG00000004605 transcript:ENSMMUT00000006505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAEPEGGAPGPQGPLEVPAPLAERPGEPGSAGEEAEEPEGSEGAEEAPRGAAAVKEA
GGGGPDRGPEAEAWGTRGAHREAEAEEGAPEVAQVPQGGEKTSSAQQVEGASPGRGAQGE
PRGEAQREPEDSAAPERQEEAEQRPEAPEGSAPGAAGDSVDAEGPAGDNIEAEGRVGDSV
EAEVPAGDSVDAEGPAGDSVDAEGPAGDSVDAEGPAGDSVDAEGLAGDSVEAEGPAGDSV
DAEGPAGDSVEAGDPVGDRVEAGDPVGDTVEAEGPAGDSMDAEGPAGGTRRVSGEPQEGG
DRSLPPQAEAIEVAAGESAGRSPGELAWDAAEETEVPGGKGSEEAGPGDSRADAVEDGVG
DGPQQESGEEEERREQSPEGPSEEAAAGGEEEFPDSSPQGEASRCAAEPEAQLSNHLAEE
GPAEGGDEAVRMNGRREDGEASEERALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILW
LKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPK
LGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLLKALRKLDNYLNSPLPDEIDAY
STEDATVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGIWRYLNNAYA
RDEFTNTCPADQEIEHAYSDVAKRMK
Download sequence
Identical sequences F6Q8W4
XP_001087698.1.72884 ENSMMUP00000006118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]