SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006119 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006119
Domain Number 1 Region: 555-702
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.41e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 483-553
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000101
Family Glutathione S-transferase (GST), N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006119   Gene: ENSMMUG00000004605   Transcript: ENSMMUT00000006506
Sequence length 704
Comment pep:known_by_projection chromosome:MMUL_1:3:11853876:11905966:-1 gene:ENSMMUG00000004605 transcript:ENSMMUT00000006506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAEPEGGAPGPQGPLEVPAPLAERPGEPGSAGEEAEEPEGSEGAEEAPRGAAAVKEA
GGGGPDRGPEAEAWGTRGAHREAEAEEGAPEVAQVPQGGEKTSSAQQVEGASPGRGAQGE
PRGEAQREPEDSAAPERQEEAEQRPEAPEGSAPGAAGDSVDAEGPAGDNIEAEGRVGDSV
EAEVPAGDSVDAEGPAGDSVDAEGPAGDSVDAEGPAGDSVDAEGLAGDSVEAEGPAGDSV
DAEGPAGDSVEAGDPVGDRVEAGDPVGDTVEAEGPAGDSMDAEGPAGGTRRVSGEPQEGG
DRSLPPQAEAIEVAAGESAGRSPGELAWDAAEETEVPGGKGSEEAGPGDSRADAVEDGVG
DGPQQESGEEEERREQSPEGPSEEAAAGGEEEFPDSSPQGEASRCAAEPEAQLSNHLAEE
GPAEGGDEAVRMNGRREDGEASEERALGQEHDITLFVKVKLIALSCLRIAIKIRNLAGYD
GESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDV
NKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLLKAL
RKLDNYLNSPLPDEIDAYSTEDATVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDF
EFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK
Download sequence
Identical sequences 9544.ENSMMUP00000006119 ENSMMUP00000006118 ENSMMUP00000006119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]