SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006193 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006193
Domain Number 1 Region: 42-382
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-87
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 916-982
Classification Level Classification E-value
Superfamily G protein-binding domain 2.88e-22
Family RhoA-binding domain 0.0000317
Further Details:      
 
Domain Number 3 Region: 1086-1176,1259-1289
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000691
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1195-1245
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 395-497
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000837
Family Myosin rod fragments 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006193   Gene: ENSMMUG00000004656   Transcript: ENSMMUT00000006584
Sequence length 1323
Comment pep:known_by_projection chromosome:MMUL_1:18:13949409:14064155:-1 gene:ENSMMUG00000004656 transcript:ENSMMUT00000006584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQ
LVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYM
VMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGH
LKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEM
LVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEE
IKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQ
LPFVGFTYYSNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQ
KCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRN
VENEVSTLKDQLEDLKKVSQNSQLANEKLSQLQKQLEEANDLLRTESDTAVRLRKSHTEM
SKSISQLESLNRELQERNRLLENSKSQTDKDYYQLQAILEAERRDRGHDSEMIGDLQARI
TSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQEVNEH
KVTKARLTDKHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVQIEKQCSMLDVDLKQS
QQKLEHLTGNKERMEDEVKNLTLLLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEI
NTLLEAKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKN
RENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEI
TDKDHTVSRLEETNSMLTKDMEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKN
INTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQM
VVKHQKELNDMQAQLVEECAHRNELQMQLASKESDIEQLRAKLLDLSDSTSVASFPSADE
TDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDID
KLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDVEMEPVQQAEKTNFQNHKGHEF
IPTLYHFPANCDACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLICPCKVSYDVTS
ARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASPRTLSTRSTANQSFRKVVKNTSG
KTR
Download sequence
Identical sequences ENSMMUP00000006193 ENSMMUP00000006193 9544.ENSMMUP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]