SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006622 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006622
Domain Number 1 Region: 80-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.84e-16
Family TRASH domain 0.0063
Further Details:      
 
Domain Number 2 Region: 897-1298
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000000106
Family Hermes transposase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006622   Gene: ENSMMUG00000005000   Transcript: ENSMMUT00000007049
Sequence length 1325
Comment pep:known chromosome:MMUL_1:1:37785685:37833194:-1 gene:ENSMMUG00000005000 transcript:ENSMMUT00000007049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGSAQQPKIQESELKISGVFSVNERPLA
QQLNPGFQLSFTSSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRC
ITRHSSPACLPPPPKKTCTNCSKDILNPKDVITTRFENSSPSKDFCSQSCLSSYELKKKP
VVTIYTKSISTKCSMCQKNADTRFEVKYQNVVHGLCSDACFSKFHSTNNLTMNCCENCGS
YCYSSSGPCQSQKVFSSTSVTAYKQNSAQIPPYALGKSLRPSAEMIETTNDSGKTELFCS
INCLSAYRVKTVTSSGVQVSCHSCKTSAIPQYHLAMSNGTIYSFCSSSCVVAFQNVFNKP
KGTNSSAMPLSQGQVVVSPPSSRSAVSTGGGNTSAVSSSSIRGSAAASLQPLAEQSQQVA
LTHTVVKLKCQQCNHLFATKPELLFYKGKMFLFCGKNCSDEYKKKNKVVAMCDYCKLQKI
IKETVRFSGVDKPFCSEVCKFLSARDFGERWGNYCKMCSYCSQTSPNLVENRLEGKLEEF
CCEDCMSKFTVLFYQMAKCDGCKRQGKLSESIKWRGNIKHFCNLFCVLEFCHQQIMNDSL
PQNKVNISKAKTAVMELPSARTDTTPVITSVVSLAKIPAALSTGNTNSVLKGAVSKEAAK
IIQDESTQADAMKFPSSQSSQPSRLLKNKGISCKPVTQTKATSCKPHTQHKECQTDLPMP
NEKNDAELDSPPSKKKRLGFFQTYDTEYLKVGFIICPGSKESSPRPQCVICGEILSSENM
KPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSIKKCLLVEKSLVKASYLIAFQTA
ASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIEDQLIQ
KVRESKWFALQIDESSEISDITLLLCYIRFIDYDCRDVKEELLFCIEMPTRITGFEIFEL
INKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAE
KLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLK
RLFELRHEIEIFLSQKHSDLTKYFHDEEWVAKLAYLSDIFSLINELNLSLQGTLTTFFNL
CNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTEITRIIFEHLEGLSQVFSD
CFPPEQDLRSGNLWIINPFMNHQNNNLTDFEEEKLTQLSSDLGLQSVFKSVSVTQFWINA
KTSYPELHERAMKFLLPFSTVYLCDAAFSALTESKQRNLLVSGPALRLAVTSLIPRIEKL
MKEKE
Download sequence
Identical sequences A0A1D5QQ85
9544.ENSMMUP00000006622 ENSMMUP00000006621 NP_001253694.1.72884 XP_014990292.1.72884 XP_014990293.1.72884 XP_014990296.1.72884 ENSMMUP00000006622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]