SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006793 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006793
Domain Number 1 Region: 923-1050,1246-1435
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.76e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Sema domain 1.44e-17
Family Sema domain 0.01
Further Details:      
 
Domain Number 3 Region: 427-520
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000306
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 4 Region: 608-712
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000153
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 5 Region: 79-131
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000103
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 540-610
Classification Level Classification E-value
Superfamily E set domains 0.000000000229
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.09
Further Details:      
 
Domain Number 7 Region: 709-798
Classification Level Classification E-value
Superfamily E set domains 0.000000994
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 8 Region: 378-410
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000903
Family Plexin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006793
Domain Number - Region: 223-255
Classification Level Classification E-value
Superfamily Plexin repeat 0.0183
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006793   Gene: ENSMMUG00000005127   Transcript: ENSMMUT00000007228
Sequence length 1465
Comment pep:known chromosome:MMUL_1:3:169520238:169880853:-1 gene:ENSMMUG00000005127 transcript:ENSMMUT00000007228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDH
EQLYIMSERQLTRVPVESCGQYRSCGECLGSGDPHCGWCVLHNTCTRKERCERSKEPRRF
ASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDGLVVGNQIQ
CYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNSCLSCVESPYR
CHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPITLKAKNLPQPQ
SGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVELTVVWNGHFNI
DNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQSPGQCTLRQHCPAQESRWLELSGA
NSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVECSPLVDGYIPA
EQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMVSLDQHSVGKPRATACPAT
SFMTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKIH
QDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKEHINICEVL
NATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPNPVFEAFGP
SGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLLCESPNLIGR
HKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAYKRKSRESDL
TLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGI
EDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRDRGNVASL
IMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKF
LKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLVLSCVSPDN
ANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGARMILQDED
ITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASKYENMIRYTG
SPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQ
KFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWV
NMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKN
WVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKYSEEILGPLD
HDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences ENSMMUP00000006793 ENSMMUP00000004084 9544.ENSMMUP00000006793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]