SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006930 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006930
Domain Number 1 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-21
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 415-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 27-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-20
Family KRAB domain (Kruppel-associated box) 0.00066
Further Details:      
 
Domain Number 7 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 568-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 153-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000295
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006930   Gene: ENSMMUG00000028875   Transcript: ENSMMUT00000007373
Sequence length 629
Comment pep:known_by_projection chromosome:MMUL_1:19:12113118:12120863:-1 gene:ENSMMUG00000028875 transcript:ENSMMUT00000007373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFGGEDRNVFFLPDSQTSEERKQYDSVAFEDVAVNFTREEWALLGPSQKTLYRDVMWE
TIRNLNCIGMKWEDTDVEDQHKNPRRSLRCLIVERFSESNQIPGSTVNEKTRGVDPCESS
VHGEVIMGCSFLNCYITFDAGHKPDECQEYGEKPHTHKQCGTTFNYHHSFQTQERPHTGK
KRYDCKECGKTFSSSGNLRRHIIVQRGGGPYICKLCGKAFFWPSLFRIHERTHTGEKPYE
CKQCFKAFRIYSSYLRHERTHTGEKPYECKHCSKAFPDYSSYVRHERTHTGEKPYTCKQC
GRAFSVSSSLRIHERTHTGEKPYECQQCGKAFHHLGSFQRHMIRHTGDGPHKCKICGRGF
DCPSSLQSHERTHTGEKPYECKQCGKALSHRSSFRSHMIMHTGDGPHKCKVCGKAFVYPS
VFQRHERTHTGEKPYECKECGKAFRISSSLQRHETTHTGEKPYKCKCGKAFIDFYSFQNH
KTTHTGEKPYECKECGKAFSCFTYLSQHKRIHTAEKPYECKTCKKAFSHFGNLKVHERIH
SGEKPYECKECRKAFSWLTCLLRHERIHTGKKSYECQQCGKAFTRSRFLGGHERIHTGEK
MHECKECGKTLSSLSSLHRHKRTHWRDTL
Download sequence
Identical sequences F7F1A2
XP_001108962.2.72884 ENSMMUP00000006930 ENSMMUP00000006930 9544.ENSMMUP00000006930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]