SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006937 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006937
Domain Number 1 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-21
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.93e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-18
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006937
Domain Number - Region: 75-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000323
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006937   Gene: ENSMMUG00000005242   Transcript: ENSMMUT00000007380
Sequence length 608
Comment pep:novel scaffold:MMUL_1:1099548049741:178123:195178:1 gene:ENSMMUG00000005242 transcript:ENSMMUT00000007380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQRLLTFRDVAIEFSVEEWQCLDTAQQDLYRNVMLENYRNLVSLGIAVSKPELITCLEER
KEPWNVKRHETVAKHPGKKCYNFRQCATSNVHFIFFISHLFIYLTSKIFQCNKCVKVFSK
LSDLNRHKIRHTGEKPFRCKACGKFFHMFSLLTQHQRIHTRESPYKCEEYGKAFNWPSNL
VKHERIHTGEKPHKCDECGKGFLQSANLIIHKRIHTGETPYKCDECDKAFKCISVLTKHK
RIHTGEKPYKCEDCGKAFKWFSTFSSHKRIHTGEKPYICKECGKAFKEASYLSGHKKIHT
GEKPYKCEECGKAFMWVSCLTRHMRTHTGEKPYNCDECGKAFKYSSNLNAHKKTHTGEKA
YKCGECGKAFKYRSTLSKHKRIHCGGKPYKCDECSKAFKSTSDLTKHKIIHTGEKPYKCE
DCGKAFKWFSILTRHKRIHTGEKLYICKGCGKAFKQASVLNGHKKVHTGEKPHKCEECGK
AFKWLSCLTRHKRSHTEEKPCTCDECGKAFKYSSNLNEHKKIHTVEKPYKCEECGKAFKC
HSSVTDHKRIHTGERPYKCKECDKIFNWASSLLKHKRIHTGRISYKCEECGKAFTSCSSL
SNHKILHT
Download sequence
Identical sequences ENSMMUP00000006937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]