SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006938 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006938
Domain Number 1 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 243-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 187-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000126
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 402-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000483
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 486-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000504
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006938   Gene: ENSMMUG00000005242   Transcript: ENSMMUT00000007381
Sequence length 648
Comment pep:novel scaffold:MMUL_1:1099548049741:178114:195172:1 gene:ENSMMUG00000005242 transcript:ENSMMUT00000007381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCFFQRLLTFRDVAIEFSVEEWQCLDTAQQDLYRNVMLENYRNLVSLGIAVSKPELITCL
EERKEPWNVKRHETVAKHPGNFYFRVLSFETVFVSVAHCFSSCSFIVLQTQIFSDVANIN
DKIRPRVRQYELYIVILLNQSLSTTHSKIFQCNKCVKVFSKLSDLNRHKIRHTGEKPFRC
KACGKFFHMFSLLTQHQRIHTRESPYKCEEYGKAFNWPSNLVKHERIHTGEKPHKCDECG
KGFLQSANLIIHKRIHTGETPYKCDECDKAFKCISVLTKHKRIHTGEKPYKCEDCGKAFK
WFSTFSSHKRIHTGEKPYICKECGKAFKEASYLSGHKKIHTGEKPYKCEECGKAFMWVSC
LTRHMRTHTGEKPYNCDECGKAFKYSSNLNAHKKTHTGEKAYKCGECGKAFKYRSTLSKH
KRIHCGGKPYKCDECSKAFKSTSDLTKHKIIHTGEKPYKCEDCGKAFKWFSILTRHKRIH
TGEKLYICKGCGKAFKQASVLNGHKKVHTGEKPHKCEECGKAFKWLSCLTRHKRSHTEEK
PCTCDECGKAFKYSSNLNEHKKIHTVEKPYKCEECGKAFKCHSSVTDHKRIHTGERPYKC
KECDKIFNWASSLLKHKRIHTGRISYKCEECGKAFTSCSSLSNHKILH
Download sequence
Identical sequences 9544.ENSMMUP00000006938 ENSMMUP00000006937 ENSMMUP00000006938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]