SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007057 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007057
Domain Number 1 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 10-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 248-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-17
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 208-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000506
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007057   Gene: ENSMMUG00000005337   Transcript: ENSMMUT00000007511
Sequence length 518
Comment pep:known chromosome:MMUL_1:19:63579826:63588303:1 gene:ENSMMUG00000005337 transcript:ENSMMUT00000007511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRPTAQGTVTFEDVAVNFSQEEWSLLSEAQRCLYHDVMLENLALISSLGCWYGAK
DEPPSKQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGARE
KTLDDDAKHHQEQKRHIGEKSYRSNAKGTSFVKNYKFHVSHEPFIFHEVGKDFLSSLRLL
QQEDIHASGKSNFETKHGIPLQGGKIHYICGESTVPFSNKHSLALHQRLLPGEGPYVCSD
SGKFTSKSNSFNNHQKVHTGKRPYQCGQCDESFWYKAHLTEHQRVHTGERPYECGECDKS
FSHKHSLVDHQRVHTGERPYECNECGKSFSHKRSLVHHQRVHTGERPYQCGECGKSFNHK
CNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTGERPYECKECRKSFRYKSHLT
EHQRVHTGERPYECRECGKCFHQKGSLIQHQQIHSGERPHECGECGKCFHQKGSLIRHQQ
IHSGERPHECGECGKCFRQKGNLIKHQRVHTGERHHEC
Download sequence
Identical sequences F7GH33
ENSMMUP00000007057 9544.ENSMMUP00000007057 ENSMMUP00000007057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]