SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007139 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007139
Domain Number 1 Region: 256-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 340-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 383-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 200-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 144-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000253
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 433-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000224
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 8 Region: 302-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000565
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 110-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000804
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007139   Gene: ENSMMUG00000005404   Transcript: ENSMMUT00000007601
Sequence length 465
Comment pep:novel chromosome:MMUL_1:9:36997065:37002323:-1 gene:ENSMMUG00000005404 transcript:ENSMMUT00000007601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLKDVIVEFTKEEWKLLTFAQRTLYKDVMLENYSHLVSVGYHVNKPNAVFKLKQGKEPW
ILEVEFPHRVLPCENIFFGNLSQNKNLTRHTYDLMSCVSELTLHKSLSINFCLQALKIKD
LKVKHQKTRTTEKAYECKECGKFFCQKSALIVHQHTHSKGKSYDCDKCGNSFSKNEDLTR
HQKIYTRDKTYECKECEKIFYHLSSLSRHLRTHAGEKPYECNQCEKSSYQKPHLIEHQKT
HTGEKPFECTECGKFFYVKAYLMVHQKTHTGEKPYECKECGKAFSQKSHLTVHQRTHTGE
KPYKCKECGKFFSRNSHLRTHQRTHTGEKPYECKECRKCFYQKSDLTVHQRTHTGEKPFE
CNKCGKTFYYKSDLTKHQRKHTGEKPYECTECGKSFSVNSVLRLHQRTHTGEKPYSCKEC
EKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAHQKTH
Download sequence
Identical sequences ENSMMUP00000007139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]