SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007459 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007459
Domain Number 1 Region: 8-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.84e-33
Family Phosducin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007459   Gene: ENSMMUG00000005643   Transcript: ENSMMUT00000007935
Sequence length 229
Comment pep:novel chromosome:MMUL_1:2:160157316:160158035:-1 gene:ENSMMUG00000005643 transcript:ENSMMUT00000007935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDPNADAEWNDILPKKGMLPPKESLKQLEKEVEEQSVVTIYKDRTLRELEDREDEFNEK
DERAIERRLAEWKASKLKNKFGEVLEISGKDYIQEVTKAGEGLWAILSLYKQGIPLSALI
NQHLNGVARKFPDVKFIKAISTTCISNYPDRNLPTGFVFLEGGIKARFIGPLVSDGMNLM
RDELEWKLSKSGAMKLDLEENPKKPIEDMLLSSVRRSVPMRRNSDSEGD
Download sequence
Identical sequences 9544.ENSMMUP00000007459 ENSMMUP00000007459 ENSMMUP00000007459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]