SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007679 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007679
Domain Number 1 Region: 51-156
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.18e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.00000209
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000237
Family Glutathione S-transferase (GST), N-terminal domain 0.0000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007679   Gene: ENSMMUG00000019630   Transcript: ENSMMUT00000008165
Sequence length 157
Comment pep:known chromosome:MMUL_1:1:112717994:112723567:1 gene:ENSMMUG00000019630 transcript:ENSMMUT00000008165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNE
KLKPEYLEGLPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPKCLDAFPNL
KDFISHFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Download sequence
Identical sequences ENSMMUP00000007679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]