SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007745 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007745
Domain Number 1 Region: 98-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000119
Family LIM domain 0.013
Further Details:      
 
Domain Number 2 Region: 36-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000191
Family LIM domain 0.011
Further Details:      
 
Domain Number 3 Region: 8-34
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000452
Family LIM domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007745
Domain Number - Region: 166-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0939
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007745   Gene: ENSMMUG00000005887   Transcript: ENSMMUT00000008239
Sequence length 213
Comment pep:novel chromosome:MMUL_1:19:41058468:41069224:1 gene:ENSMMUG00000005887 transcript:ENSMMUT00000008239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPLLGICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQED
FLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIY
CVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRR
CYPLAGHLLCRRCHLRRLQPGPVPSPTVHVTEL
Download sequence
Identical sequences G7NM31 G7PX72
9544.ENSMMUP00000007745 ENSMMUP00000007745 ENSMMUP00000007745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]