SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007940 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007940
Domain Number 1 Region: 6-578
Classification Level Classification E-value
Superfamily ARM repeat 4.53e-116
Family Clathrin adaptor core protein 0.000000000000179
Further Details:      
 
Domain Number 2 Region: 837-949
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 8.44e-52
Family Clathrin adaptor appendage, alpha and beta chain-specific domain 0.00000047
Further Details:      
 
Domain Number 3 Region: 719-835
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 9.07e-43
Family Alpha-adaptin ear subdomain-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007940   Gene: ENSMMUG00000006048   Transcript: ENSMMUT00000008452
Sequence length 949
Comment pep:known_by_projection chromosome:MMUL_1:16:30859127:30992736:1 gene:ENSMMUG00000006048 transcript:ENSMMUT00000008452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKECREVNVHVFSILLKQSSCLGLSKYWD
YRCEPPCLLPMRIPTLPCSVLSAKVQTAELVKKKKKKKISFRRLIKCLSVAVVANAVAAL
SEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERV
TPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALR
NINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATE
VDVDFVRKAVRAIGRCAIKVEASQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYP
NKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQL
TLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVL
SEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDA
GDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDS
LLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYV
APKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPST
PLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVE
DGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLY
QSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Download sequence
Identical sequences ENSMMUP00000007939 ENSMMUP00000007940 9544.ENSMMUP00000007940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]