SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008047 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008047
Domain Number 1 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 22-77
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 315-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 579-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 258-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-17
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 9 Region: 223-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000354
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008047
Domain Number - Region: 104-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000609
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 179-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.021
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008047   Gene: ENSMMUG00000006121   Transcript: ENSMMUT00000008560
Sequence length 640
Comment pep:known chromosome:MMUL_1:19:63340371:63354184:1 gene:ENSMMUG00000006121 transcript:ENSMMUT00000008560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALVNTPQIPMATEEFVKPSQGHVTFEDIAVYFSQEEWGLLDEAQRCLYHDVMLENF
SLMASVGCLHGIETEEAPSEHTISAQGVSQARTPKPGPSIPNAHSCEMCILVMKDILYLT
EHQGTLPWQKPYTSAASGKWFSFGSNLQLHQNQDSGEKHVRKEESSAFLLNSCKIPLSDN
LFPCKDVEKDFPTILGLLQHQTTHSREEYAHRSREIFQQRRYKCEQVFNEKVHVTEHQRV
HTGEKAYKRREYGKSLNSKYSFVEHQRTHNAEKPYVCSICGKSFLHKQTLVGHQQRIHTR
ERSYVCIECGKSLSSKYSLVEHQRTHNGEKPYVCNVCGKSFRHKQTFVGHQQRIHTGERP
YVCIECGKSFIHSYDRIRHQRVHTGERAYQCSECGKSFIYKQSLLDHQRIHTGERPYECK
ECGKAFIHKKRLLEHQRIHTGEKPYVCIICGKSFIRSSDYMRHQRIHTGERAYECSDCGK
AFISKQTLLKHHKIHTRERPYECSECGKGFYLEVKLLQHQRIHTREQLYDCNECGKVFSH
QKRLLEHQKVHTGEKPCECSECGKCFRHRTSLIQHQKVHSGERPYNCTACEKAFIYKNKL
VEHQRIHTGEKPYECGKCGKAFNKRYSLVRHQKVHTTEEP
Download sequence
Identical sequences F7HA82
ENSMMUP00000031402 ENSMMUP00000008047 XP_001093701.1.72884 9544.ENSMMUP00000008047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]