SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008251 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008251
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.95e-49
Family Phosducin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008251   Gene: ENSMMUG00000006271   Transcript: ENSMMUT00000008779
Sequence length 241
Comment pep:known_by_projection chromosome:MMUL_1:5:73803409:73837645:1 gene:ENSMMUG00000006271 transcript:ENSMMUT00000008779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDPNEDTEWNDILRDFGILPPKEESKDEIEEMVLGLQKEAMVKPFEKMTLAQLKEAEDE
FDEEDMQAIETYREKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDVWVIIHLYRS
SIPMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIL
ECGGINLKLEELEWKLAEVGAIQTDLEENPQKDIVDMMVSSIRNTSIHDDSDSSNSDNDT
K
Download sequence
Identical sequences A0A2K5U7V0 F7H2W1
ENSMMUP00000008251 XP_001087954.1.72884 XP_005555314.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]