SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008321 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008321
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily SAICAR synthase-like 8.83e-64
Family SAICAR synthase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008321   Gene: ENSMMUG00000016366   Transcript: ENSMMUT00000008851
Sequence length 239
Comment pep:known_by_projection chromosome:MMUL_1:5:72918667:72944271:-1 gene:ENSMMUG00000016366 transcript:ENSMMUT00000008851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYK
FYPPKVELFFKDDANNDPQWSEEQLIAAKLCFAGLVIGQTEVDIMSHATQAIFEILEKSW
LPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRGPQRSNS
Download sequence
Identical sequences ENSMMUP00000008321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]