SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008489 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008489
Domain Number 1 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 238-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 7-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 198-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-16
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 282-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000208
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008489   Gene: ENSMMUG00000006440   Transcript: ENSMMUT00000009033
Sequence length 588
Comment pep:known chromosome:MMUL_1:19:41228131:41243561:-1 gene:ENSMMUG00000006440 transcript:ENSMMUT00000009033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALALVSFEDVVVTFTGEEWGQLDLAQRTLYQEVMLETCRLLVSLGHPVPKPELIYL
LEHGQDLWTVKRGLSQSTCAGEKAKPKTTEPTVSQLAFSEEFSFQEFLAQRSSRDSRFGQ
ARDEEKLIEIQEGNLRPGTNLHKEICPGKLSYKHDDLEPDDSLGLRVLQERVTPQDAVHE
HDSQRPEKDPIIDARNNPYTCMECGKGFSKKWALVRHQQIHAGVKPYECNECGKACRYMA
DVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHTGDKPYECKECGKAFTHRSSFIQ
HNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYECSKCGKAFTHRSTFIQHNMT
HTGEKPFLCKECGKAFCLNSSFTQHMRIHTGEKPYECSECGKAFTHRSTFIRHKRTHTGE
KPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSKCGKAFTHHSVFIRHNRTHSGQKPLE
CKECAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHKRIHTGEKPFECKEC
EKAFCDNFALTQHMRTHTGEKPFECNECGKTFSHSSSFTHHRKIHTRV
Download sequence
Identical sequences F7HS86
XP_001092675.1.72884 ENSMMUP00000008489 9544.ENSMMUP00000008489 ENSMMUP00000008489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]