SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008505 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008505
Domain Number 1 Region: 228-421
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-57
Family Kelch motif 0.00000723
Further Details:      
 
Domain Number 2 Region: 378-518
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-38
Family Kelch motif 0.0000527
Further Details:      
 
Domain Number 3 Region: 2-91
Classification Level Classification E-value
Superfamily POZ domain 8.24e-27
Family BTB/POZ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008505   Gene: ENSMMUG00000006454   Transcript: ENSMMUT00000009050
Sequence length 532
Comment pep:known_by_projection chromosome:MMUL_1:2:89188344:89215133:-1 gene:ENSMMUG00000006454 transcript:ENSMMUT00000009050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIGDHKFSAHRIVLTASIPYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLA
IDQQNVQSLLMGASFLQLQSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSF
IHQHFVEVSMSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPE
LLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRC
CTSIAGLIYAVGGLNSAGDSLNVVEVFDPIANHWERCRPMTTARSRVGVAVVNGLLYAIG
GYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVET
YSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAG
MLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVAS
CGRLYAVGGYDGQSNLSSVEMYDPETDRWTFMAPMACHEGGVGVGCIPLLTI
Download sequence
Identical sequences ENSMMUP00000008505 9544.ENSMMUP00000008505 ENSMMUP00000008505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]