SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008572 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008572
Domain Number 1 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 59-119
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 534-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 575-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 240-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000515
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008572   Gene: ENSMMUG00000006510   Transcript: ENSMMUT00000009125
Sequence length 664
Comment pep:known_by_projection chromosome:MMUL_1:4:28715867:28725239:-1 gene:ENSMMUG00000006510 transcript:ENSMMUT00000009125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEVVLSDESSGPPSQLLWTPQDTQLPQERALLPAQCPAFTKDGSQGNLLQADITLMSQA
QESVTFEDVAVNFTNREWQSLTYAQRHLYKHVMLENYGNMVSLGFPFPKPPLISHLERGV
EPCVQDPQDRESLSCSYPVSTDKMWPENEKASSQQQIFENEEAYWMKSNSLLKVDSQDPE
VREVCVQEVKLENQWKTPIREKLREEKEGSEEVTCKKRKNQKVLRENPNPNSKYSRCNST
AQKLHECARCGKNFSWHSDLILHEQIHSAEKPHGCDACGKAFKTRNQLSVHQIIHTGEKR
FNCIQCGKAFNSRSALCRHKKTHSGEKPHECRDCGKAFKTRNCLCMHQLIHTGEKPYECN
CCGKAFQFKHSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECSECGR
AFSRSSDLSKHKRIHIREKHYGCPQCGKDFSIKAELTKHRRMHTEEKRYRCEECGKAFRH
NCKRRAHEREHTGEKPYQCGHCGKTFQDRHCLTIHQRIHTGEKPYKCLECGKAFGGKSNL
TNHQRIHTGEKRHKCEVCGMAFHHSSVLRQHKRIHTGEKPYTCSECGTSFRQGSALIGHK
RVHTGEKPYECEECGKAFRVSSNLTGHKKRKHQVWRTHELDGSRKSLSPVTVSQTSAVSI
LTSA
Download sequence
Identical sequences 9544.ENSMMUP00000008572 ENSMMUP00000034260 ENSMMUP00000008572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]